PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009787242.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 640aa    MW: 70320.2 Da    PI: 7.0605
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009787242.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS348.51.1e-1062736403374
            GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                     + ++e+A+a+s+g ++ a ++L+rls+ ++ +g+++qRl+ay++ AL++r++     +    p+ e    +s+e++ +++ ++evsP++k+++++
  XP_009787242.1 273 QSITEAATAISEGINHVAVEILTRLSQVSNVRGSSIQRLTAYMVSALRSRVNP----TDYPPPVLEL---HSKEHTVSTQNLYEVSPCFKLGFMA 360
                     67899***********************************************9....2222333333...599999999**************** PP

            GRAS  98 aNqaIleavege..ervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledl 189
                     aN aIlea+  +  +++H+iDfd++qG+Q++ Ll+aLa+++ e+p+ l+iT++ +   g  ++l+++g  L+ +A+++gv + fnv +a +++dl
  XP_009787242.1 361 ANLAILEALTDHptNKIHVIDFDVGQGGQYLHLLHALAAKKsEKPAVLKITAFTELVGGVDDRLNAIGVELKAVANKIGVCLYFNV-MACKITDL 454
                     ***********9999***********************77737777*********9989**************************9.7999**** PP

            GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerik 284
                     + e+L ++++EalaVn++++l+rl+desv++e+ rde+L+ vk+lsPkvv+vveqe++ n+++Fl+r+ ea+ yy alfdsl+a+++r++ er+ 
  XP_009787242.1 455 SREKLGLEHDEALAVNFAFKLYRLPDESVTTENLRDELLRRVKGLSPKVVTVVEQELNGNTAPFLARVNEACGYYGALFDSLDATVSRDNLERVR 549
                     *********************************************************************************************** PP

            GRAS 285 vErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk..sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     +E+  l+r+  n vaceg++r+er+e ++kWr+r+++aGF + p+s+ +a++  + l+     + g++v+e+sg +++gW++r+L+++SaWr
  XP_009787242.1 550 IEEG-LSRKMANSVACEGRDRVERCEVFGKWRARMSMAGFVQRPMSQLVANSLCSKLNSGTrgNPGFTVNEQSGGICFGWMGRTLTVASAWR 640
                     ****.******************************************9999887777654437999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098546.527245618IPR005202Transcription factor GRAS
PfamPF035143.8E-104273640IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 640 aa     Download sequence    Send to blast
MSSGFPGDFY GAGGINTGRS TMNNNTLRSQ LSGILPDPAT QIVLGRPNLM GKRSLAEFQQ  60
QQQFQFLQQQ QQQNQQQQMI LQQQQQQQGL GFYLRNVKPR NYQQASPIDF SAVASSISSE  120
FSSFSSNSNA STMNTRHTLP VLQQLRSQPA LPSANTNISG FLHPGTQNYS TGVHSRATIG  180
QELLSQESEK KMMNQLQELE KQLLDDVDDE DGDTVSVVTN NEWSETIQNL ISPCQSQNQN  240
QNQNQKLASL SPSSSTSSCA SSTESPPISC PKQSITEAAT AISEGINHVA VEILTRLSQV  300
SNVRGSSIQR LTAYMVSALR SRVNPTDYPP PVLELHSKEH TVSTQNLYEV SPCFKLGFMA  360
ANLAILEALT DHPTNKIHVI DFDVGQGGQY LHLLHALAAK KSEKPAVLKI TAFTELVGGV  420
DDRLNAIGVE LKAVANKIGV CLYFNVMACK ITDLSREKLG LEHDEALAVN FAFKLYRLPD  480
ESVTTENLRD ELLRRVKGLS PKVVTVVEQE LNGNTAPFLA RVNEACGYYG ALFDSLDATV  540
SRDNLERVRI EEGLSRKMAN SVACEGRDRV ERCEVFGKWR ARMSMAGFVQ RPMSQLVANS  600
LCSKLNSGTR GNPGFTVNEQ SGGICFGWMG RTLTVASAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-412686409375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7302480.0KJ730248.1 Nicotiana tabacum GRAS10 protein (GRAS10) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009787242.10.0PREDICTED: scarecrow-like protein 8
SwissprotQ9FYR71e-158SCL8_ARATH; Scarecrow-like protein 8
TrEMBLA0A075F2G50.0A0A075F2G5_TOBAC; GRAS10 protein
STRINGPGSC0003DMT4000262400.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA40232443
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.11e-141SCARECROW-like 8